Skip to main content
Streptavidin (Cat. No. 2-0208-xxx) replaces Streptavidin (Cat. No. 2-0203-xxx) since January 2026. Compared to the previous Streptavidin (Cat. No. 2-0203-xxx), the new Streptavidin (Cat. No. 2-0208-xxx) is characterized by higher purity and low endotoxin content.

Streptavidin is a tetrameric protein composed of identic subunits. Each subunit specifically binds one biotin molecule with fM affinity, which makes it one of the strongest non-covalent interactions known. The preparation contains an N- and C-terminal shortened variant (core streptavidin) with improved properties regarding homogeneity, solubility, resistance towards proteolytic degradation, and accessibility of the biotin binding pocket as compared to native streptavidin. The streptavidin:biotin system is widely used for immobilization and detection of biotinylated molecules, like proteins and nucleic acids.

The product is animal component free (ACF) & animal origin free (AOF) and without any affinity tag.

IBA Lifesciences provides bulk amounts of lyophilized streptavidin in reliable and high quality at competitive prices to generate streptavidin-coated surfaces (microplates, SPR chips, beads) or detection reagents conjugated with, e.g., fluorescent dyes. Please note that streptavidin is not applicable for detection, immobilization, and purification of Strep-tag®II and Twin-Strep-tag® fusion proteins, since the binding affinity for both tags is too low.

For bulk order please get in contact: strep-tag@iba-lifesciences.com

Specifications

Form: Lyophilized powder
Possible Application: Coating of surfaces
Purity: > 95% determined by SEC
Reconstitution: Water
Sequence: MEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS
Size: 13.3 kDa per subunit
Source: Recombinant, expression in E. coli
Specific Activity: > 17 U/mg
Storage: -20 °C
Stability: 24 months after shipping
Shipping: Room temperature

Related Products

Strep-Tactin®
Reversible immobilization of biotinylated analytes or Strep-tag®II and Twin-Strep-tag® fusion proteins